> >
Type SKU Price HT Quantity
  • 100 μl
HPA074833-100
  • 25 μl
HPA074833-25

You have not filled quantity

A standard cart already exists with this name

Variants without price will not be added to cart

General Information
Description frizzled class receptor 4

Product Information

Purchasing Information
Certification RUO
French code (NACRES) NA.41
UNSPSC code 12352203
Country of origin (manufacturing) SE
EU customs code 30021010
Vendor country SE
Human origin No
Target Details
Other names CD344 , EVR1
Immunogen sequence PVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSA
Identification
NCBI (gene ID) 8322
Uniprot Q9ULV1
Brand
Brand Atlas Antibodies
Product properties
Supplier category 3 HPA
Datasheet/manual https://www.atlasantibodies.com/api/print_datasheet/HPA074833.pdf
MSDS https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf
Marketing brochures https://www.atlasantibodies.com/resources/antibody-applications/white-papers-and-brochures/
Applications notes https://www.atlasantibodies.com/resources/antibody-applications/white-papers-and-brochures/
Videos - tutorials https://yris.ozyme.fr/alt-video-tuto
Product presentation https://yris.ozyme.fr/alt-anticorps-ihc
Clonality Polyclonal
Concentration Lot Dependent
Conjugate / tag non conjugated
Host Rabbit
Special format Concentrated
Immunogen Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Isotype (antibody class) IgG
Technical presentation https://atlasantibodies.com/products/FZD4-antibody-HPA074833
Validated reactivity Human
Usage
Shelf-life (months) 12
Shipping temperature Room T°
Dilution for application See Product datasheet
Storage temperature NA
Applications IF-IC (cultured cells)

Ask the community a question about this product: