PrEST Antigen HOXB4

Shipped by OZYME

Type SKU Price HT Quantity
  • 100 μl
5-10
APREST83782

You have not filled quantity

A wishlist already exists with this name

Variants without price will not be added to cart

General Information
Description

homeobox B4

Product Information

Purchasing Information
Certification RUO
French code (NACRES) NA.47
UNSPSC code 12352202
Country of origin (manufacturing) SE
EU customs code 30021010
Human origin No
Vendor country SE
Target Details
Immunogen sequence CEAVSSSPPPPPCAQNPLHPSPSHSACKEPVVY
Other names HOX2F , HOX2
Identification
Uniprot P17483
NCBI (gene ID) 3214
Brand
Brand Atlas Antibodies
Product properties
Product presentation https://yris.ozyme.fr/alt-anticorps-ihc
Videos - tutorials https://yris.ozyme.fr/alt-video-tuto
Applications notes https://www.atlasantibodies.com/resources/antibody-applications/white-papers-and-brochures/
Marketing brochures https://www.atlasantibodies.com/resources/antibody-applications/white-papers-and-brochures/
MSDS https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_urea.pdf
Datasheet/manual https://www.atlasantibodies.com/api/print_datasheet/APrEST83782.pdf
Supplier category 3 APREST
Control type Antigenic Peptide
Concentration ≥0.5 mg/ml
Technical presentation https://atlasantibodies.com/products/HOXB4-antigen-APrEST83782
Usage
Dilution for application See Product datasheet
Shelf-Life (months) 12
Shipping temperature -20°C
Storage temperature -20°C

List of all reviews