PrEST Antigen RHBDD1

Shipped by OZYME

Type SKU Price HT Quantity
  • 100 μl
5-10
APREST91782

You have not filled quantity

A wishlist already exists with this name

Variants without price will not be added to cart

General Information
Description

rhomboid domain containing 1

Product Information

Purchasing Information
Certification RUO
French code (NACRES) NA.47
UNSPSC code 12352202
Country of origin (manufacturing) SE
EU customs code 30021010
Human origin No
Vendor country SE
Target Details
Immunogen sequence FLNPQKPLYSSCLSVEKCYQQKDWQRLLLSPLHHADDWHLYFNMASMLWKGINLERRLGS
Other names DKFZp547E052
Identification
Uniprot Q8TEB9
NCBI (gene ID) 84236
Brand
Brand Atlas Antibodies
Product properties
Applications notes https://www.atlasantibodies.com/resources/antibody-applications/white-papers-and-brochures/
Datasheet/manual https://www.atlasantibodies.com/api/print_datasheet/APrEST91782.pdf
Supplier category 3 APREST
MSDS https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_urea.pdf
Marketing brochures https://www.atlasantibodies.com/resources/antibody-applications/white-papers-and-brochures/
Videos - tutorials https://yris.ozyme.fr/alt-video-tuto
Product presentation https://yris.ozyme.fr/alt-anticorps-ihc
Control type Antigenic Peptide
Concentration ≥0.5 mg/ml
Technical presentation https://atlasantibodies.com/products/RHBDD1-antigen-APrEST91782
Usage
Dilution for application See Product datasheet
Shelf-Life (months) 12
Shipping temperature -20°C
Storage temperature -20°C

List of all reviews