PrEST Antigen ZNF691

Delivered by OZYME

>
Type SKU Price Quantity
  • 100 μl
APREST86157
Preparation delay: 10 days

You have not filled quantity

A standard cart already exists with this name

Variants without price will not be added to cart

General Information
Description zinc finger protein 691

Product Information

Purchasing Information
Certification RUO
French code (NACRES) NA.47
UNSPSC code 12352202
Country of origin (manufacturing) SE
EU customs code 30021010
Human origin No
Vendor country SE
Target Details
Immunogen sequence KPWQKVTVRARELGDPIAHPRHEADEKPFICAQ
Identification
NCBI (gene ID) 51058
Uniprot Q5VV52
Brand
Brand Atlas Antibodies
Product properties
Supplier category 3 APREST
Datasheet/manual https://www.atlasantibodies.com/api/print_datasheet/APrEST86157.pdf
MSDS https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_urea.pdf
Marketing brochures https://www.atlasantibodies.com/resources/antibody-applications/white-papers-and-brochures/
Applications notes https://www.atlasantibodies.com/resources/antibody-applications/white-papers-and-brochures/
Videos - tutorials https://yris.ozyme.fr/alt-video-tuto
Product presentation https://yris.ozyme.fr/alt-anticorps-ihc
Control type Antigenic Peptide
Concentration ≥0.5 mg/ml
Technical presentation https://atlasantibodies.com/products/ZNF691-antigen-APrEST86157
Usage
Dilution for application See Product datasheet
Shelf-life (months) 12
Shipping temperature -20°C
Storage temperature -20°C

Ask the community a question about this product: