Conditionnement SKU Prix HT Quantité
  • 100 μl
5-10
HPA062719-100
  • 25 μl
5-10
HPA062719-25

Vous n'avez pas renseigné de quantité

Une liste de souhaits porte déjà ce nom

Le produit ne peut pas être ajouté au panier

General Information
Description

chromosome 19 open reading frame 73

Informations produit

Purchasing Information
Certification RUO
French code (NACRES) NA.41
UNSPSC code 12352203
Country of origin (manufacturing) SE
EU customs code 30021010
Vendor country SE
Human origin No
Target Details
Other names FLJ10490
Immunogen sequence MRLKVGFQGGGCFRKDALCLEGGVSARWARAPHSAPLRPPRELHAAPPPATPTQT
Identification
NCBI (gene ID) 55150
Uniprot Q9NVV2
Brand
Brand Atlas Antibodies
Product properties
Supplier category 3 HPA
Datasheet/manual https://www.atlasantibodies.com/api/print_datasheet/HPA062719.pdf
MSDS https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf
Marketing brochures https://www.atlasantibodies.com/resources/antibody-applications/white-papers-and-brochures/
Applications notes https://www.atlasantibodies.com/resources/antibody-applications/white-papers-and-brochures/
Videos - tutorials https://yris.ozyme.fr/alt-video-tuto
Product presentation https://yris.ozyme.fr/alt-anticorps-ihc
Clonality Polyclonal
Concentration Lot Dependent
Conjugate / tag non conjugated
Host Rabbit
Special format Concentrated
Immunogen Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
isotype (antibody class) IgG
Technical presentation https://atlasantibodies.com/products/C19orf73-antibody-HPA062719
Validated reactivity Human
Usage
Shelf-Life (months) 12
Shipping temperature Room T°
Dilution for application See Product datasheet
Storage temperature NA
Applications IF-IC (cultured cells) , IHC (ImmunoHistoChemistry)

Commentaires - Partagez votre expérience utilisateur