Anti-LSS (remplace HPA032060)

Expédié par OZYME

Conditionnement SKU Prix HT Quantité
  • 25 μl
5-10
HPA032060-25
  • 100 μl
5-10
HPA032060-100

Vous n'avez pas renseigné de quantité

Une liste de souhaits porte déjà ce nom

Le produit ne peut pas être ajouté au panier

General Information
Description

lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase)

Informations produit

Purchasing Information
Certification RUO
French code (NACRES) NA.41
UNSPSC code 12352203
Country of origin (manufacturing) SE
EU customs code 30021010
Vendor country SE
Human origin No
Target Details
Other names OSC
Immunogen sequence IQALLEAGGHHRPEFSSCLQKAHEFLRLSQVPDNPPDYQKYYRQMRKGGFSFSTLDCGWIVSDCTAEALKAVLLLQEKCPHVTEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVEC
Identification
NCBI (gene ID) 4047
Uniprot P48449
Brand
Brand Atlas Antibodies
Product properties
Supplier category 3 HPA
Datasheet/manual https://www.atlasantibodies.com/api/print_datasheet/HPA032060.pdf
MSDS https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf
Marketing brochures https://www.atlasantibodies.com/resources/antibody-applications/white-papers-and-brochures/
Applications notes https://www.atlasantibodies.com/resources/antibody-applications/white-papers-and-brochures/
Videos - tutorials https://yris.ozyme.fr/alt-video-tuto
Product presentation https://yris.ozyme.fr/alt-anticorps-ihc
Clonality Polyclonal
Concentration Lot Dependent
Conjugate / tag non conjugated
Host Rabbit
Special format Concentrated
Immunogen Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
isotype (antibody class) IgG
Technical presentation https://atlasantibodies.com/products/LSS-antibody-HPA032060
Validated reactivity Human
Usage
Shelf-Life (months) 12
Shipping temperature Room T°
Dilution for application See Product datasheet
Storage temperature NA
Applications IHC (ImmunoHistoChemistry) , WB (Western Blot)

Commentaires - Partagez votre expérience utilisateur